PDB entry 1g0d

View 1g0d on RCSB PDB site
Description: crystal structure of red sea bream transglutaminase
Class: transferase
Keywords: tissue transglutaminase,acyltransferase
Deposited on 2000-10-06, released 2001-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-glutamine gamma-glutamyltransferase
    Species: Pagrus major [TaxId:143350]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g0da1, d1g0da2, d1g0da3, d1g0da4
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g0dA (A:)
    masykglivdvngrshennlahrtreidrerlivrrgqpfsitlqcsdslppkhhlelvl
    hlgkrdevvikvqkehgardkwwfnqqgaqdeilltlhspanavighyrlavlvmspdgh
    iveradkisfhmlfnpwcrddmvylpdesklqeyvmnedgviymgtwdyirsipwnygqf
    edyvmdicfevldnspaalknsemdiehrsdpvyvgrtitamvnsngdrgvltgrweepy
    tdgvapyrwtgsvpilqqwskagvrpvkygqcwvfaavactvlrclgiptrpitnfasah
    dvdgnlsvdfllnerlesldsrqrsdsswnfhcwveswmsredlpegndgwqvldptpqe
    lsdgefccgpcpvaaikegnlgvkydapfvfaevnadtiywivqkdgqrrkitedhasvg
    knistksvygnhredvtlhykypegsqkerevykkagrrvtepsneiaeqgrlqlsikha
    qpvfgtdfdvivevkneggrdahaqltmlamavtynslrrgecqrktisvtvpahkahke
    vmrlhyddyvrcvsehhlirvkalldapgengpimtvaniplstpellvqvpgkavvwep
    ltayvsftnplpvplkggvftlegagllsatqihvngavapsgkvsvklsfspmrtgvrk
    llvdfdsdrlkdvkgvttvvvhkkyrslitglhtd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g0dA (A:)
    glivdvngrshennlahrtreidrerlivrrgqpfsitlqcsdslppkhhlelvlhlgkr
    devvikvqkehgardkwwfnqqgaqdeilltlhspanavighyrlavlvmspdghivera
    dkisfhmlfnpwcrddmvylpdesklqeyvmnedgviymgtwdyirsipwnygqfedyvm
    dicfevldnspaalknsemdiehrsdpvyvgrtitamvnsngdrgvltgrweepytdgva
    pyrwtgsvpilqqwskagvrpvkygqcwvfaavactvlrclgiptrpitnfasahdvdgn
    lsvdfllnerlesldsrqrsdsswnfhcwveswmsredlpegndgwqvldptpqelsdge
    fccgpcpvaaikegnlgvkydapfvfaevnadtiywivqkdgqrrkitedhasvgknist
    ksvygnhredvtlhykypegsqkerevykkagrrvtrlqlsikhaqpvfgtdfdvivevk
    neggrdahaqltmlamavtynslrrgecqrktisvtvpahkahkevmrlhyddyvrcvse
    hhlirvkalldapgpimtvaniplstpellvqvpgkavvwepltayvsftnplpvplkgg
    vftlegagllsatqihvngavapsgkvsvklsfspmrtgvrkllvdfdsdrlkdvkgvtt
    vvvhkk