PDB entry 1g0b

View 1g0b on RCSB PDB site
Description: carbonmonoxy liganded equine hemoglobin ph 8.5
Deposited on 2000-10-05, released 2000-12-27
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-27, with a file datestamp of 2000-12-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.178
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1g0ba_
  • Chain 'B':
    Domains in SCOP 1.55: d1g0bb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0bA (A:)
    vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
    kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
    vhasldkflssvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0bB (B:)
    vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
    kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
    dftpelqasyqkvvagvanalahkyh