PDB entry 1fzf

View 1fzf on RCSB PDB site
Description: crystal structure of fragment double-d from human fibrin with the peptide ligand gly-his-arg-pro-amide
Class: blood coagulation
Keywords: blood coagulation, plasma, platelet, fibrinogen, fibrin
Deposited on 1998-12-28, released 1999-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.233
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fzfa_
  • Chain 'B':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fzfb1, d1fzfb2
  • Chain 'C':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fzfc1, d1fzfc2
  • Chain 'D':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fzfd_
  • Chain 'E':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fzfe1, d1fzfe2
  • Chain 'F':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fzff1, d1fzff2
  • Chain 'M':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fzfA (A:)
    vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
    revdlkdyedqqkqleqviakdllpsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzfA (A:)
    viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
    eqviakd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fzfB (B:)
    dnenvvneysselekhqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeyc
    rtpctvscnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviq
    nrqdgsvdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptellie
    medwkgdkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngm
    ffstydrdndgwltsdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtdd
    gvvwmnwkgswysmrkmsmkirpffpqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzfB (B:)
    vnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsgkeceeiir
    kggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdpykqgfgnv
    atntdgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahyggftvqnean
    kyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwltsdprkqcsk
    edgggwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmrkmsmkirp
    ffp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fzfC (C:)
    kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihd
    itgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkkn
    wiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkv
    gpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegnca
    eqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkii
    pfnrltigegqqhhlggak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzfC (C:)
    thdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihditgkdcqdiankga
    kqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegfghlspt
    gttefwlgnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyrltyayf
    aggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgwwmnkcha
    ghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkiipfnrlt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fzfD (D:)
    vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
    revdlkdyedqqkqleqviakdllpsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzfD (D:)
    llqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkqleqv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1fzfE (E:)
    dnenvvneysselekhqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeyc
    rtpctvscnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviq
    nrqdgsvdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptellie
    medwkgdkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngm
    ffstydrdndgwltsdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtdd
    gvvwmnwkgswysmrkmsmkirpffpqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzfE (E:)
    nlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsgkeceeiirkggetse
    myliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdpykqgfgnvatntdgk
    nycglpgeywlgndkisqltrmgptelliemedwkgdkvkahyggftvqneankyqisvn
    kyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwltsdprkqcskedgggww
    ynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmrkmsmkirpffp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1fzfF (F:)
    kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihd
    itgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkkn
    wiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkv
    gpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegnca
    eqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkii
    pfnrltigegqqhhlggak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzfF (F:)
    ylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihditgkdcqdiankgakqsglyf
    ikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegfghlsptgttefwl
    gnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyrltyayfaggdagd
    afdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgwwmnkchaghlngvy
    yqggtyskastpngydngiiwatwktrwysmkkttmkiipfnrlt
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.