PDB entry 1fzc

View 1fzc on RCSB PDB site
Description: crystal structure of fragment double-d from human fibrin with two different bound ligands
Class: blood coagulation
Keywords: blood coagulation, plasma protein, crosslinking
Deposited on 1998-05-19, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.22
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fzca_
  • Chain 'B':
    Compound: fibrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fzcb1, d1fzcb2
  • Chain 'C':
    Compound: fibrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fzcc1, d1fzcc2
  • Chain 'D':
    Compound: fibrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fzcd_
  • Chain 'E':
    Compound: fibrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fzce1, d1fzce2
  • Chain 'F':
    Compound: fibrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fzcf1, d1fzcf2
  • Chain 'G':
    Compound: fibrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FZC (0-3)
  • Chain 'H':
    Compound: fibrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FZC (0-3)
  • Chain 'I':
    Compound: fibrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FZC (0-3)
  • Chain 'J':
    Compound: fibrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FZC (0-3)
  • Heterogens: NAG, MAN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fzcA (A:)
    vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
    revdlkdyedqqkqleqviakdllpsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzcA (A:)
    ievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdy
    edqqkqleqviakd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fzcB (B:)
    dnenvvneysselekhqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeyc
    rtpctvscnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviq
    nrqdgsvdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptellie
    medwkgdkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngm
    ffstydrdndgwltsdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtdd
    gvvwmnwkgswysmrkmsmkirpffpqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzcB (B:)
    lyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsgke
    ceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdpyk
    qgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahyggft
    vqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwltsdp
    rkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmrkm
    smkirpff
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fzcC (C:)
    kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihd
    itgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkkn
    wiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkv
    gpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegnca
    eqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkii
    pfnrltigegqqhhlggak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzcC (C:)
    easilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihditgkdcqdi
    ankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegfg
    hlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyrl
    tyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgwwm
    nkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkiipfnrltige
    g
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fzcD (D:)
    vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
    revdlkdyedqqkqleqviakdllpsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzcD (D:)
    ievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdy
    edqqkqleqviakd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1fzcE (E:)
    dnenvvneysselekhqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeyc
    rtpctvscnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviq
    nrqdgsvdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptellie
    medwkgdkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngm
    ffstydrdndgwltsdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtdd
    gvvwmnwkgswysmrkmsmkirpffpqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzcE (E:)
    lyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsgke
    ceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdpyk
    qgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahyggft
    vqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwltsdp
    rkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmrkm
    smkirpff
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1fzcF (F:)
    kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihd
    itgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkkn
    wiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkv
    gpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegnca
    eqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkii
    pfnrltigegqqhhlggak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzcF (F:)
    easilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihditgkdcqdi
    ankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegfg
    hlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyrl
    tyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgwwm
    nkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkiipfnrltige
    g
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.