PDB entry 1fzb

View 1fzb on RCSB PDB site
Description: crystal structure of crosslinked fragment d
Class: blood coagulation
Keywords: blood coagulation, plasma, platelet, fibrinogen, fibrin
Deposited on 1997-08-05, released 1997-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.241
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fzba_
  • Chain 'B':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fzbb1, d1fzbb2
  • Chain 'C':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02679 (0-End)
      • conflict (0)
    Domains in SCOPe 2.07: d1fzbc1, d1fzbc2
  • Chain 'D':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fzbd_
  • Chain 'E':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fzbe1, d1fzbe2
  • Chain 'F':
    Compound: fibrinogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02679 (0-End)
      • conflict (0)
    Domains in SCOPe 2.07: d1fzbf1, d1fzbf2
  • Chain 'G':
    Compound: peptide ligand gprg
    Database cross-references and differences (RAF-indexed):
    • PDB 1FZB (0-3)
  • Chain 'H':
    Compound: peptide ligand gprg
    Database cross-references and differences (RAF-indexed):
    • PDB 1FZB (0-3)
  • Heterogens: NAG, CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fzbA (A:)
    vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
    revdlkdyedqqkqleqviakdllpsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzbA (A:)
    edlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralare
    vdlkdyedqqkqleqviakdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fzbB (B:)
    dnenvvneysselekhqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeyc
    rtpctvscnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviq
    nrqdgsvdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptellie
    medwkgdkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngm
    ffstydrdndgwltsdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtdd
    gvvwmnwkgswysmrkmsmkirpffpqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzbB (B:)
    khqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvs
    gkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwd
    pykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahyg
    gftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwlt
    sdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysm
    rkmsmkirpffp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fzbC (C:)
    kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihd
    itgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkkn
    wiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkv
    gpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegnca
    eqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkii
    pfnrltigegqqhhlggak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzbC (C:)
    kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihd
    itgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkkn
    wiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkv
    gpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegnca
    eqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkii
    pfnrltige
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fzbD (D:)
    vsedlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsrala
    revdlkdyedqqkqleqviakdllpsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzbD (D:)
    edlrsrievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralare
    vdlkdyedqqkqleqviakdl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1fzbE (E:)
    dnenvvneysselekhqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeyc
    rtpctvscnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviq
    nrqdgsvdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptellie
    medwkgdkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngm
    ffstydrdndgwltsdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtdd
    gvvwmnwkgswysmrkmsmkirpffpqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzbE (E:)
    khqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvs
    gkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwd
    pykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahyg
    gftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwlt
    sdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysm
    rkmsmkirpffp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1fzbF (F:)
    kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihd
    itgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkkn
    wiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkv
    gpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegnca
    eqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkii
    pfnrltigegqqhhlggak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzbF (F:)
    kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihd
    itgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkkn
    wiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkv
    gpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegnca
    eqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkii
    pfnrltigegq
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.