PDB entry 1fyv

View 1fyv on RCSB PDB site
Description: crystal structure of the tir domain of human tlr1
Deposited on 2000-10-03, released 2000-11-22
The last revision prior to the SCOP 1.59 freeze date was dated 2000-11-22, with a file datestamp of 2000-11-22.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.254
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1fyva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fyvA (A:)
nipleelqrnlqfhafisysghdsfwvknellpnlekegmqiclhernfvpgksivenii
tcieksyksifvlspnfvqsewchyelyfahhnlfhegsnslilillepipqysipssyh
klkslmarrtylewpkekskrglfwanlraainiklteqak