PDB entry 1fy9

View 1fy9 on RCSB PDB site
Description: crystal structure of the hexa-substituted mutant of the molecular chaperonin groEL apical domain
Class: chaperone
Keywords: Chaperone, Stabilizing mutant
Deposited on 2000-09-28, released 2000-11-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.265
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 60 kd chaperonin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-192)
      • cloning artifact (0-6)
      • engineered (28)
      • engineered (39)
      • engineered (49)
      • engineered (121)
      • engineered (124)
      • engineered (142)
    Domains in SCOPe 2.06: d1fy9a1, d1fy9a2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fy9A (A:)
    glvprgsegmqfdrgylspyfinkpetgevelespfillvdkkisnirellpvleavaka
    gkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvise
    elgmklekatledlgqakrvvitkdtttiidgvgeeaaiqgrvaqirqqieeatsdydre
    klqervaklaggv