PDB entry 1fy9

View 1fy9 on RCSB PDB site
Description: crystal structure of the hexa-substituted mutant of the molecular chaperonin groel apical domain
Deposited on 2000-09-28, released 2000-11-22
The last revision prior to the SCOP 1.69 freeze date was dated 2000-11-22, with a file datestamp of 2000-11-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.265
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1fy9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fy9A (A:)
glvprgsegmqfdrgylspyfinkpetgevelespfillvdkkisnirellpvleavaka
gkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvise
elgmklekatledlgqakrvvitkdtttiidgvgeeaaiqgrvaqirqqieeatsdydre
klqervaklaggv