PDB entry 1fy5

View 1fy5 on RCSB PDB site
Description: fusarium oxysporum trypsin at atomic resolution
Class: hydrolase
Keywords: beta barrel
Deposited on 2000-09-28, released 2001-02-07
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 0.81 Å
R-factor: 0.124
AEROSPACI score: 1.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Fusarium oxysporum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fy5a_
  • Chain 'B':
    Compound: gly-ala-lys
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fy5A (A:)
    ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr
    tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv
    agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds
    ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya
    

  • Chain 'B':
    No sequence available.