PDB entry 1fxz

View 1fxz on RCSB PDB site
Description: crystal structure of soybean proglycinin a1ab1b homotrimer
Class: plant protein
Keywords: Proglycinin, Glycinin, Legumin, Seed Storage Protein
Deposited on 2000-09-28, released 2001-09-28
The last revision prior to the SCOP 1.75 freeze date was dated 2002-12-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.199
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycinin g1
    Species: Glycine max
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fxza1, d1fxza2
  • Chain 'B':
    Compound: glycinin g1
    Species: Glycine max
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fxzb1, d1fxzb2
  • Chain 'C':
    Compound: glycinin g1
    Species: Glycine max
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fxzc1, d1fxzc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fxzA (A:)
    fssreqpqqnecqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnal
    rrpsytngpqeiyiqqgkgifgmiypgcpstfeepqqpqqrgqssrpqdrhqkiynfreg
    dliavptgvawwmynnedtpvvavsiidtnslenqldqmprrfylagnqeqeflkyqqeq
    gghqsqkgkhqqeeeneggsilsgftleflehafsvdkqiaknlqgenegedkgaivtvk
    gglsvikpptdeqqqrpqeeeeeeedekpqckgkdkhcqrprgsqsksrrngidetictm
    rlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefgslrknamfvphynlnan
    siiyalngraliqvvncngervfdgelqegrvlivpqnfvvaarsqsdnfeyvsfktndt
    pmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkflvppqesqkrava
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fxzA (A:)
    necqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnalrrpsytngp
    qeiyiqqgkgifgmiypgcpstrhqkiynfregdliavptgvawwmynnedtpvvavsii
    dtnslenqldqmprrfylagnqeqeflkyqqggsilsgftleflehafsvdkqiaknlqg
    ekgaivtvkgglsvikpictmrlrhnigqtsspdiynpqagsvttatsldfpalswlrls
    aefgslrknamfvphynlnansiiyalngraliqvvncngervfdgelqegrvlivpqnf
    vvaarsqsdnfeyvsfktndtpmigtlagansllnalpeeviqhtfnlksqqarqiknnn
    pfkflvppqes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fxzB (B:)
    fssreqpqqnecqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnal
    rrpsytngpqeiyiqqgkgifgmiypgcpstfeepqqpqqrgqssrpqdrhqkiynfreg
    dliavptgvawwmynnedtpvvavsiidtnslenqldqmprrfylagnqeqeflkyqqeq
    gghqsqkgkhqqeeeneggsilsgftleflehafsvdkqiaknlqgenegedkgaivtvk
    gglsvikpptdeqqqrpqeeeeeeedekpqckgkdkhcqrprgsqsksrrngidetictm
    rlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefgslrknamfvphynlnan
    siiyalngraliqvvncngervfdgelqegrvlivpqnfvvaarsqsdnfeyvsfktndt
    pmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkflvppqesqkrava
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fxzB (B:)
    necqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnalrrpsytngp
    qeiyiqqgkgifgmiypgcpstrhqkiynfregdliavptgvawwmynnedtpvvavsii
    dtnslenqldqmprrfylagnqeqeflkyqqggsilsgftleflehafsvdkqiaknlqg
    ekgaivtvkgglsvikpictmrlrhnigqtsspdiynpqagsvttatsldfpalswlrls
    aefgslrknamfvphynlnansiiyalngraliqvvncngervfdgelqegrvlivpqnf
    vvaarsqsdnfeyvsfktndtpmigtlagansllnalpeeviqhtfnlksqqarqiknnn
    pfkflvppqes
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fxzC (C:)
    fssreqpqqnecqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnal
    rrpsytngpqeiyiqqgkgifgmiypgcpstfeepqqpqqrgqssrpqdrhqkiynfreg
    dliavptgvawwmynnedtpvvavsiidtnslenqldqmprrfylagnqeqeflkyqqeq
    gghqsqkgkhqqeeeneggsilsgftleflehafsvdkqiaknlqgenegedkgaivtvk
    gglsvikpptdeqqqrpqeeeeeeedekpqckgkdkhcqrprgsqsksrrngidetictm
    rlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefgslrknamfvphynlnan
    siiyalngraliqvvncngervfdgelqegrvlivpqnfvvaarsqsdnfeyvsfktndt
    pmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkflvppqesqkrava
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fxzC (C:)
    necqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnalrrpsytngp
    qeiyiqqgkgifgmiypgcpstrhqkiynfregdliavptgvawwmynnedtpvvavsii
    dtnslenqldqmprrfylagnqeqeflkyqqggsilsgftleflehafsvdkqiaknlqg
    ekgaivtvkgglsvikpictmrlrhnigqtsspdiynpqagsvttatsldfpalswlrls
    aefgslrknamfvphynlnansiiyalngraliqvvncngervfdgelqegrvlivpqnf
    vvaarsqsdnfeyvsfktndtpmigtlagansllnalpeeviqhtfnlksqqarqiknnn
    pfkflvppqes