PDB entry 1fx0

View 1fx0 on RCSB PDB site
Description: Crystal structure of the chloroplast F1-ATPase from spinach
Class: hydrolase
Keywords: latent ATPase, thermal stability, potential tentoxin binding site, HYDROLASE
Deposited on 2000-09-25, released 2001-09-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.319
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP synthase alpha chain
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1fx0a1, d1fx0a2, d1fx0a3
  • Chain 'B':
    Compound: ATP synthase beta chain
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1fx0b1, d1fx0b2, d1fx0b3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fx0A (A:)
    matiradeiskiireriegynrevkvvntgtvlqvgdgiarihgldevmagelvefeegt
    igialnlesnnvgvvlmgdglmiqegssvkatgriaqipvseaylgrvinalakpidgrg
    eitasesrliespapgimsrrsvyeplqtgliaidamipvgrgqreliigdrqtgktava
    tdtilnqqgqnvicvyvaigqkassvaqvvtnfqergameytivvaetadspatlqylap
    ytgaalaeyfmyrerhtliiyddlskqaqayrqmslllrrppgreaypgdvfylhsrlle
    raaklssllgegsmtalpivetqagdvsayiptnvisitdgqiflsadlfnagirpainv
    gisvsrvgsaaqikamkkvagklklelaqfaeleafaqfasdldkatqnqlargqrlrel
    lkqpqsapltveeqvmtiytgtngyldsleldqvrkylvelrtyvktnkpefqeiisstk
    tfteeaeallkeaiqeqmerfllqeqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fx0A (A:)
    kvvntgtvlqvgdgiarihgldevmagelvefeegtigialnlesnnvgvvlmgdglmiq
    egssvkatgriaqipvseaylgrvinalakpidgrgeitasesrliespapgimsrrsvy
    eplqtgliaidamipvgrgqreliigdrqtgktavatdtilnqqgqnvicvyvaigqkas
    svaqvvtnfqergameytivvaetadspatlqylapytgaalaeyfmyrerhtliiyddl
    skqaqayrqmslllrrppgreaypgdvfylhsrlleraaklssllgegsmtalpivetqa
    gdvsayiptnvisitdgqiflsadlfnagirpainvgisvsrvgsaaqikamkkvagklk
    lelaqfaeleafaqfasdldkatqnqlargqrlrellkqpqsapltveeqvmtiytgtng
    yldsleldqvrkylvelrtyvktnkpefqeiisstktfteeaeallkeaiqeqmerf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fx0B (B:)
    mrinpttsdpgvstlekknlgriaqiigpvlnvafppgkmpniynalivkgrdtagqpmn
    vtcevqqllgnnrvravamsatdgltrgmevidtgaplsvpvggptlgrifnvlgepvdn
    lrpvdtrttspihrsapaftqldtklsifetgikvvnllapyrrggkiglfggagvgktv
    limelinniakahggvsvfggvgertregndlymemkesgvineqniaeskvalvygqmn
    eppgarmrvgltaltmaeyfrdvneqdvllfidnifrfvqagsevsallgrmpsavgyqp
    tlstemgslqeritstkegsitsiqavyvpaddltdpapattfahldattvlsrglaakg
    iypavdpldststmlqprivgeehyeiaqrvketlqrykelqdiiailgldelseedrlt
    vararkierflsqpffvaevftgspgkyvglaetirgfqlilsgeldslpeqafylvgni
    deatakamnlemesklkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fx0B (B:)
    nlgriaqiigpvlnvafppgkmpniynalivkgrdtagqpmnvtcevqqllgnnrvrava
    msatdgltrgmevidtgaplsvpvggptlgrifnvlgepvdnlrpvdtrttspihrsapa
    ftqldtklsifetgikvvnllapyrrggkiglfggagvgktvlimelinniakahggvsv
    fggvgertregndlymemkesgvineqniaeskvalvygqmneppgarmrvgltaltmae
    yfrdvneqdvllfidnifrfvqagsevsallgrmpsavgyqptlstemgslqeritstke
    gsitsiqavyvpaddltdpapattfahldattvlsrglaakgiypavdpldststmlqpr
    ivgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpffva
    evftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideata