PDB entry 1fx0

View 1fx0 on RCSB PDB site
Description: crystal structure of the chloroplast f1-atpase from spinach
Deposited on 2000-09-25, released 2001-09-25
The last revision prior to the SCOP 1.63 freeze date was dated 2001-09-25, with a file datestamp of 2001-09-25.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.35
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fx0A (A:)
    kvvntgtvlqvgdgiarihgldevmagelvefeegtigialnlesnnvgvvlmgdglmiq
    egssvkatgriaqipvseaylgrvinalakpidgrgeitasesrliespapgimsrrsvy
    eplqtgliaidamipvgrgqreliigdrqtgktavatdtilnqqgqnvicvyvaigqkas
    svaqvvtnfqergameytivvaetadspatlqylapytgaalaeyfmyrerhtliiyddl
    skqaqayrqmslllrrppgreaypgdvfylhsrlleraaklssllgegsmtalpivetqa
    gdvsayiptnvisitdgqiflsadlfnagirpainvgisvsrvgsaaqikamkkvagklk
    lelaqfaeleafaqfasdldkatqnqlargqrlrellkqpqsapltveeqvmtiytgtng
    yldsleldqvrkylvelrtyvktnkpefqeiisstktfteeaeallkeaiqeqmerf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fx0B (B:)
    nlgriaqiigpvlnvafppgkmpniynalivkgrdtagqpmnvtcevqqllgnnrvrava
    msatdgltrgmevidtgaplsvpvggptlgrifnvlgepvdnlrpvdtrttspihrsapa
    ftqldtklsifetgikvvnllapyrrggkiglfggagvgktvlimelinniakahggvsv
    fggvgertregndlymemkesgvineqniaeskvalvygqmneppgarmrvgltaltmae
    yfrdvneqdvllfidnifrfvqagsevsallgrmpsavgyqptlstemgslqeritstke
    gsitsiqavyvpaddltdpapattfahldattvlsrglaakgiypavdpldststmlqpr
    ivgeehyeiaqrvketlqrykelqdiiailgldelseedrltvararkierflsqpffva
    evftgspgkyvglaetirgfqlilsgeldslpeqafylvgnideata