PDB entry 1fw4

View 1fw4 on RCSB PDB site
Description: crystal structure of e. coli fragment tr2c from calmodulin to 1.7 a resolution
Class: metal binding protein
Keywords: EF-hand, Helix-loop-helix, Fragment, Calcium, TR2C, C-terminal domain, Calmodulin, METAL BINDING PROTEIN
Deposited on 2000-09-21, released 2001-05-02
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.218
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1fw4a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fw4A (A:)
    dtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvn
    yeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fw4A (A:)
    seeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvnyee
    fvqmm