PDB entry 1fw1

View 1fw1 on RCSB PDB site
Description: Glutathione transferase zeta/maleylacetoacetate isomerase
Deposited on 2000-09-20, released 2001-09-26
The last revision prior to the SCOP 1.61 freeze date was dated 2001-09-26, with a file datestamp of 2001-09-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.234
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fw1A (A:)
    kpilysyfrsscswrvrialalkgidyktvpinlikdggqqfskdfqalnpmkqvptlki
    dgitihqslaiieyleetrptprllpqdpkkrasvrmisdliaggiqplqnlsvlkqvge
    emqltwaqnaitcgfnaleqilqstagiycvgdevtmadlclvpqvanaerfkvdltpyp
    tissinkrllvleafqvshpcrqpdtpt