PDB entry 1fvk

View 1fvk on RCSB PDB site
Description: the 1.7 angstrom structure of wild type disulfide bond formation protein (dsba)
Deposited on 1996-08-28, released 1997-08-20
The last revision prior to the SCOP 1.55 freeze date was dated 1997-08-20, with a file datestamp of 1997-08-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.198
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fvkA (A:)
    aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsek
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fvkB (B:)
    aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsek