PDB entry 1fvi

View 1fvi on RCSB PDB site
Description: crystal structure of chlorella virus dna ligase-adenylate
Deposited on 2000-09-20, released 2000-11-22
The last revision prior to the SCOP 1.67 freeze date was dated 2000-11-22, with a file datestamp of 2000-11-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fviA (A:)
    aitkpllaatleniedvqfpclatpkiagirsvkqtqmlsrtfkpirnsvmnrlltellp
    egsdgeisiegatfqdttsavmtghkmynakfsyywfdyvtddplkkyidrvedmknyit
    vhphilehaqvkiiplipveinnitellqyerdvlskgfegvmirkpdgkykfgrstlke
    gillkmkqfkdaeatiismtalfkntntktkdnfgyskrsthksgkveedvmgsievdyd
    gvvfsigtgfdadqrrdfwqnkesyigkmvkfkyfemgskdcprfpvfigirheedr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fviA (A:)
    aitkpllaatleniedvqfpclatpkiagirsvkqtqmlsrtfkpirnsvmnrlltellp
    egsdgeisiegatfqdttsavmtghakfsyywfdyvtddplkkyidrvedmknyitvhph
    ilehaqvkiiplipveinnitellqyerdvlskgfegvmirkpdgkykfgrstlkegill
    kmkqfkdaeatiismtalfksgkveedvmgsievdydgvvfsigtgfdadqrrdfwqnke
    syigkmvkfkyfemprfpvfigir