PDB entry 1fvd

View 1fvd on RCSB PDB site
Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling
Deposited on 1992-10-20, released 1993-10-31
The last revision prior to the SCOP 1.59 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.179
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fvdA (A:)
    diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasflesgvps
    rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fvdB (B:)
    evqlvesggglvqpggslrlscaasgfnikdtyihwvrqapgkglewvariyptngytry
    adsvkgrftisadtskntlylqmnslraedtavyycsrwggdgfyamdvwgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fvdC (C:)
    diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasflesgvps
    rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fvdD (D:)
    evqlvesggglvqpggslrlscaasgfnikdtyihwvrqapgkglewvariyptngytry
    adsvkgrftisadtskntlylqmnslraedtavyycsrwggdgfyamdvwgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc