PDB entry 1fv1

View 1fv1 on RCSB PDB site
Description: structural basis for the binding of an immunodominant peptide from myelin basic protein in different registers by two hla-dr2 alleles
Deposited on 2000-09-18, released 2000-09-27
The last revision prior to the SCOP 1.59 freeze date was dated 2000-11-22, with a file datestamp of 2000-11-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.233
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fv1A (A:)
    eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
    iavdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwl
    rngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fv1B (B:)
    gdtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaey
    wnsqkdfledrraavdtycrhnygvgesftvqrrvepkvtvypartqtlqhhnllvcsvn
    gfypgsievrwfrnsqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsv
    tspltvewra
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fv1D (D:)
    ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
    avdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwlr
    ngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fv1E (E:)
    gdtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaey
    wnsqkdfledrraavdtycrhnygvgesftvqrrvepkvtvypartqtlqhhnllvcsvn
    gfypgsievrwfrnsqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsv
    tspltvewra