PDB entry 1fuu

View 1fuu on RCSB PDB site
Description: yeast initiation factor 4a
Deposited on 2000-09-15, released 2000-11-29
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-29, with a file datestamp of 2000-11-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.244
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fuuA (A:)
    qiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtg
    ktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhaciggtsfv
    edaeglrdaqivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftll
    ppttqvvllsatmpndvlevttkfmrnpvrilvkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fuuB (B:)
    qiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtg
    ktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhaciggtsfv
    edaeglrdaqivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftll
    ppttqvvllsatmpndvlevttkfmrnpvrilvkkdeltlegikqfyvnveeeeykyecl
    tdlydsisvtqavifcntrrkveelttklrndkftvsaiysdlpqqerdtimkefrsgss
    rilistdllargidvqqvslvinydlpankenyihrigrggrfgrkgvainfvtnedvga
    mrelekfystqieelpsdiatlln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fuuB (B:)
    qiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtg
    ktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhaciggtsfv
    edaeglrdaqivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftll
    ppttqvvllsatmpndvlevttkfmrnpvrilvkkdeltlegikqfyvnveeeeykyecl
    tdlydsisvtqavifcntrrkveelttklrndkftvsaiysdlpqqerdtimkefrsgss
    rilistdllargidvqqvslvinydlpankenyihrigrggkgvainfvtnedvgamrel
    ekfystqieelpsdiatlln