PDB entry 1fum

View 1fum on RCSB PDB site
Description: structure of the e. coli fumarate reductase respiratory complex
Deposited on 1999-06-03, released 1999-06-28
The last revision prior to the SCOP 1.57 freeze date was dated 1999-06-28, with a file datestamp of 1999-06-27.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.222
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fumA (A:)
    qtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaeggsaavaqdhd
    sfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggmk
    iertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegtl
    vqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdmefvqyhptglpgsg
    ilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelgprdkvsqafwhewrk
    gntistprgdvvyldlrhlgekklherlpficelakayvgvdpvkepipvrptahytmgg
    ietdqncetrikglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagng
    neaaieaqaagveqrlkdlvnqdggenwakirdemglameegcgiyrtpelmqktidkla
    elqerfkrvritdtssvfntdllytielghglnvaecmahsamarkesrgahqrldegct
    erddvnflkhtlafrdadgttrleysdvkittlpp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fumB (B:)
    aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
    icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvdmthfiesleaikpyi
    ignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnpefigpaaitlahryn
    edsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiqqgkvesskdfliatl
    kpr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fumC (C:)
    ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
    dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
    ivilfvalyw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fumD (D:)
    inpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaqs
    figrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fumM (M:)
    qtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaeggsaavaqdhd
    sfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggmk
    iertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegtl
    vqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdmefvqyhptglpgsg
    ilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelgprdkvsqafwhewrk
    gntistprgdvvyldlrhlgekklherlpficelakayvgvdpvkepipvrptahytmgg
    ietdqncetrikglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagng
    neaaieaqaagveqrlkdlvnqdggenwakirdemglameegcgiyrtpelmqktidkla
    elqerfkrvritdtssvfntdllytielghglnvaecmahsamarkesrgahqrldegct
    erddvnflkhtlafrdadgttrleysdvkittlpp
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fumN (N:)
    aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
    icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvdmthfiesleaikpyi
    ignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnpefigpaaitlahryn
    edsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiqqgkvesskdfliatl
    kpr
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fumO (O:)
    ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
    dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
    ivilfvalyw
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fumP (P:)
    inpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaqs
    figrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti