PDB entry 1fuk

View 1fuk on RCSB PDB site
Description: crystal structure of the carboxy terminal domain of yeast eif4a
Deposited on 2000-09-15, released 2000-11-29
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-29, with a file datestamp of 2000-11-29.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.221
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1fuka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fukA (A:)
    ikqfyvnveeeeykyecltdlydsisvtqavifcntrrkveelttklrndkftvsaiysd
    lpqqerdtimkefrsgssrilistdllargidvqqvslvinydlpankenyihrigrggr
    fgrkgvainfvtnedvgamrelekfystqieelpsdiatlln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fukA (A:)
    ikqfyvnveeeeykyecltdlydsisvtqavifcntrrkveelttklrndkftvsaiysd
    lpqqerdtimkefrsgssrilistdllargidvqqvslvinydlpankenyihrigrggg
    vainfvtnedvgamrelekfystqieelpsdiatlln