PDB entry 1fui

View 1fui on RCSB PDB site
Description: l-fucose isomerase from escherichia coli
Deposited on 1997-04-14, released 1997-10-15
The last revision prior to the SCOP 1.57 freeze date was dated 1997-10-15, with a file datestamp of 1997-10-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.162
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fuiA (A:)
    mkkislpkigirpvidgrrmgvresleeqtmnmakataallteklrhacgaavecvisdt
    ciagmaeaaaceekfssqnvgltitvtpcwcygsetidmdptrpkaiwgfngterpgavy
    laaalaahsqkgipafsiyghdvqdaddtsipadveekllrfaraglavasmkgksylsl
    ggvsmgiagsivdhnffeswlgmkvqavdmtelrrridqkiydeaelemalawadknfry
    gedennkqyqrnaeqsravlresllmamcirdmmqgnskladigrveeslgynaiaagfq
    gqrhwtdqypngdtaeailnssfdwngvrepfvvatendslngvamlmghqltgtaqvfa
    dvrtywspeaiervtghkldglaehgiihlinsgsaaldgsckqrdsegnptmkphweis
    qqeadaclaatewcpaiheyfrgggyssrflteggvpftmtrvniikglgpvlqiaegws
    velpkdvhdilnkrtnstwpttwfaprltgkgpftdvysvmanwganhgvltighvgadf
    itlasmlripvcmhnveetkvyrpsawaahgmdiegqdyracqnygplykr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fuiB (B:)
    mkkislpkigirpvidgrrmgvresleeqtmnmakataallteklrhacgaavecvisdt
    ciagmaeaaaceekfssqnvgltitvtpcwcygsetidmdptrpkaiwgfngterpgavy
    laaalaahsqkgipafsiyghdvqdaddtsipadveekllrfaraglavasmkgksylsl
    ggvsmgiagsivdhnffeswlgmkvqavdmtelrrridqkiydeaelemalawadknfry
    gedennkqyqrnaeqsravlresllmamcirdmmqgnskladigrveeslgynaiaagfq
    gqrhwtdqypngdtaeailnssfdwngvrepfvvatendslngvamlmghqltgtaqvfa
    dvrtywspeaiervtghkldglaehgiihlinsgsaaldgsckqrdsegnptmkphweis
    qqeadaclaatewcpaiheyfrgggyssrflteggvpftmtrvniikglgpvlqiaegws
    velpkdvhdilnkrtnstwpttwfaprltgkgpftdvysvmanwganhgvltighvgadf
    itlasmlripvcmhnveetkvyrpsawaahgmdiegqdyracqnygplykr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fuiC (C:)
    mkkislpkigirpvidgrrmgvresleeqtmnmakataallteklrhacgaavecvisdt
    ciagmaeaaaceekfssqnvgltitvtpcwcygsetidmdptrpkaiwgfngterpgavy
    laaalaahsqkgipafsiyghdvqdaddtsipadveekllrfaraglavasmkgksylsl
    ggvsmgiagsivdhnffeswlgmkvqavdmtelrrridqkiydeaelemalawadknfry
    gedennkqyqrnaeqsravlresllmamcirdmmqgnskladigrveeslgynaiaagfq
    gqrhwtdqypngdtaeailnssfdwngvrepfvvatendslngvamlmghqltgtaqvfa
    dvrtywspeaiervtghkldglaehgiihlinsgsaaldgsckqrdsegnptmkphweis
    qqeadaclaatewcpaiheyfrgggyssrflteggvpftmtrvniikglgpvlqiaegws
    velpkdvhdilnkrtnstwpttwfaprltgkgpftdvysvmanwganhgvltighvgadf
    itlasmlripvcmhnveetkvyrpsawaahgmdiegqdyracqnygplykr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fuiD (D:)
    mkkislpkigirpvidgrrmgvresleeqtmnmakataallteklrhacgaavecvisdt
    ciagmaeaaaceekfssqnvgltitvtpcwcygsetidmdptrpkaiwgfngterpgavy
    laaalaahsqkgipafsiyghdvqdaddtsipadveekllrfaraglavasmkgksylsl
    ggvsmgiagsivdhnffeswlgmkvqavdmtelrrridqkiydeaelemalawadknfry
    gedennkqyqrnaeqsravlresllmamcirdmmqgnskladigrveeslgynaiaagfq
    gqrhwtdqypngdtaeailnssfdwngvrepfvvatendslngvamlmghqltgtaqvfa
    dvrtywspeaiervtghkldglaehgiihlinsgsaaldgsckqrdsegnptmkphweis
    qqeadaclaatewcpaiheyfrgggyssrflteggvpftmtrvniikglgpvlqiaegws
    velpkdvhdilnkrtnstwpttwfaprltgkgpftdvysvmanwganhgvltighvgadf
    itlasmlripvcmhnveetkvyrpsawaahgmdiegqdyracqnygplykr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fuiE (E:)
    mkkislpkigirpvidgrrmgvresleeqtmnmakataallteklrhacgaavecvisdt
    ciagmaeaaaceekfssqnvgltitvtpcwcygsetidmdptrpkaiwgfngterpgavy
    laaalaahsqkgipafsiyghdvqdaddtsipadveekllrfaraglavasmkgksylsl
    ggvsmgiagsivdhnffeswlgmkvqavdmtelrrridqkiydeaelemalawadknfry
    gedennkqyqrnaeqsravlresllmamcirdmmqgnskladigrveeslgynaiaagfq
    gqrhwtdqypngdtaeailnssfdwngvrepfvvatendslngvamlmghqltgtaqvfa
    dvrtywspeaiervtghkldglaehgiihlinsgsaaldgsckqrdsegnptmkphweis
    qqeadaclaatewcpaiheyfrgggyssrflteggvpftmtrvniikglgpvlqiaegws
    velpkdvhdilnkrtnstwpttwfaprltgkgpftdvysvmanwganhgvltighvgadf
    itlasmlripvcmhnveetkvyrpsawaahgmdiegqdyracqnygplykr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fuiF (F:)
    mkkislpkigirpvidgrrmgvresleeqtmnmakataallteklrhacgaavecvisdt
    ciagmaeaaaceekfssqnvgltitvtpcwcygsetidmdptrpkaiwgfngterpgavy
    laaalaahsqkgipafsiyghdvqdaddtsipadveekllrfaraglavasmkgksylsl
    ggvsmgiagsivdhnffeswlgmkvqavdmtelrrridqkiydeaelemalawadknfry
    gedennkqyqrnaeqsravlresllmamcirdmmqgnskladigrveeslgynaiaagfq
    gqrhwtdqypngdtaeailnssfdwngvrepfvvatendslngvamlmghqltgtaqvfa
    dvrtywspeaiervtghkldglaehgiihlinsgsaaldgsckqrdsegnptmkphweis
    qqeadaclaatewcpaiheyfrgggyssrflteggvpftmtrvniikglgpvlqiaegws
    velpkdvhdilnkrtnstwpttwfaprltgkgpftdvysvmanwganhgvltighvgadf
    itlasmlripvcmhnveetkvyrpsawaahgmdiegqdyracqnygplykr