PDB entry 1fu5

View 1fu5 on RCSB PDB site
Description: nmr structure of the n-sh2 domain of the p85 subunit of pi3-kinase complexed to a doubly phosphorylated peptide derived from polyomavirus middle t antigen
Deposited on 2000-09-14, released 2001-02-21
The last revision prior to the SCOP 1.57 freeze date was dated 2001-02-21, with a file datestamp of 2001-02-21.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1fu5a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fu5A (A:)
  gmnnnmslqdaewywgdisreevneklrdtadgtflvrdastkmhgdytltlrkggnnks
  ikifhrdgkygfsdpltfnsvvelinhyrneslaqynpkldvkllypvsky