PDB entry 1fu5

View 1fu5 on RCSB PDB site
Description: nmr structure of the n-sh2 domain of the p85 subunit of pi3-kinase complexed to a doubly phosphorylated peptide derived from polyomavirus middle t antigen
Class: peptide binding protein
Keywords: protein-peptide complex, PEPTIDE BINDING PROTEIN
Deposited on 2000-09-14, released 2001-02-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol 3-kinase regulatory alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63787 (0-110)
      • conflict (59)
    Domains in SCOPe 2.08: d1fu5a_
  • Chain 'B':
    Compound: doubly phosphorylated middle t antigen
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03076 (0-14)
      • modified residue (3)
      • modified residue (10)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fu5A (A:)
gmnnnmslqdaewywgdisreevneklrdtadgtflvrdastkmhgdytltlrkggnnks
ikifhrdgkygfsdpltfnsvvelinhyrneslaqynpkldvkllypvsky

  • Chain 'B':
    No sequence available.