PDB entry 1ft8

View 1ft8 on RCSB PDB site
Description: crystal structure of the rna-binding domain of the mrna export factor tap
Deposited on 2000-09-12, released 2000-12-11
The last revision prior to the SCOP 1.61 freeze date was dated 2000-12-11, with a file datestamp of 2000-12-11.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.303
AEROSPACI score: -1.87 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ft8A (A:)
    nwfkitipygrkydkawllsmiqskcsvpftpiefhyentraqffvedastasalkavny
    kildrenrrisiiinssapphtilnelkpeqveqlklimskrydgsqqvldlkglrsdpd
    lvaqnidvvlnrrscmaatlriieenipellslnlsnnrlyrlddmssivqkapnlkiln
    lsgnelksereldkikglkleelwldgnslcdtfrdqstyisairerfpkllrldghelp
    ppiaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ft8A (A:)
    nwfkitipygrkydkawllsmiqskcsvpftpiefhyentraqffvedastasalkavny
    kildrenrrisiiinssapphtelkpeqveqlklimskrydgsqqvldlkglrsdpdlva
    qnidvvlnrrscmaatlriieenipellslnlsnnrlyrlddmssivqkapnlkilnlsg
    nelksereldkikglkleelwldgnslcdtfrdqstyisairerfpkllrldghelpppi
    af
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ft8B (B:)
    elkpeqveqlklimskrydgsqqvldlkglrsdpdlvaqnidvvlnrrscmaatlriiee
    nipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwl
    dgnslcdtfrdqstyisairerfpkllrldghelpppiafdveap
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ft8C (C:)
    knwfkitipygrkydkawllsmiqskcsvpftpiefhyentraqffvedastasalkavn
    ykildrenrrisiiinssapphtilnelkpeqveqlklimskrydgsqqvldlkglrsdp
    dlvaqnidvvlnrrscmaatlriieenipellslnlsnnrlyrlddmssivqkapnlkil
    nlsgnelksereldkikglkleelwldgnslcdtfrdqstyisairerfpkllrldghel
    pppiaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ft8C (C:)
    knwfkitipygrkydkawllsmiqskcsvpftpiefhyentraqffvedastasalkavn
    ykildrenrrisiiinssapphlnelkpeqveqlklimskrydgsqqvldlkglrsdpdl
    vaqnidvvlnrrscmaatlriieenipellslnlsnnrlyrlddmssivqkapnlkilnl
    sgnelksereldkikglkleelwldgnslcdtfrdqstyisairerfpkllrldghelpp
    piaf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ft8D (D:)
    lkpeqveqlklimskrydgsqqvldlkglrsdpdlvaqnidvvlnrrscmaatlriieen
    ipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwld
    gnslcdtfrdqstyisairerfpkllrldghelpppiafdve
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ft8E (E:)
    wfkitipygrkydkawllsmiqskcsvpftpiefhyentraqffvedastasalkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ft8E (E:)
    wfkitdkawllsmiqskcsvpftpiefhqffvedastasalkav