PDB entry 1fsy

View 1fsy on RCSB PDB site
Description: ampc beta-lactamase from e. coli complexed with inhibitor cloxacillinboronic acid
Class: hydrolase
Keywords: cephalosporinase, beta-lactamase, serine hydrolase
Deposited on 2000-09-11, released 2001-03-14
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.196
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cephalosporinase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fsya_
  • Chain 'B':
    Compound: cephalosporinase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fsyb_
  • Heterogens: PO4, 105, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fsyA (A:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnala
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fsyB (B:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnala