PDB entry 1fsp

View 1fsp on RCSB PDB site
Description: nmr solution structure of bacillus subtilis spo0f protein, 20 structures
Class: response regulator
Keywords: response regulator, sporulation, two-component systems, bacterial signal transduction, phospho-relay, (beta/alpha)5 protein
Deposited on 1997-06-05, released 1997-12-10
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stage 0 sporulation protein f
    Species: Bacillus subtilis
    Gene: SPO0F
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fspa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fspA (A:)
mmnekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
lksn