PDB entry 1fsl

View 1fsl on RCSB PDB site
Description: ferric soybean leghemoglobin complexed with nicotinate
Class: oxygen transport
Keywords: heme, respiratory protein, nitrogen fixation, multigene family, oxygen transport
Deposited on 1995-12-12, released 1996-06-26
The last revision prior to the SCOP 1.75 freeze date was dated 1996-06-26, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.158
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leghemoglobin a
    Species: Glycine max
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fsla_
  • Chain 'B':
    Compound: leghemoglobin a
    Species: Glycine max
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fslb_
  • Heterogens: HEM, NIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fslA (A:)
    vaftekqdalvsssfeafkanipqysvvfytsilekapaakdlfsflangvdptnpkltg
    haeklfalvrdsagqlkasgtvvadaalgsvhaqkavtdpqfvvvkeallktikaavgdk
    wsdelsrawevaydelaaaikka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fslB (B:)
    vaftekqdalvsssfeafkanipqysvvfytsilekapaakdlfsflangvdptnpkltg
    haeklfalvrdsagqlkasgtvvadaalgsvhaqkavtdpqfvvvkeallktikaavgdk
    wsdelsrawevaydelaaaikka