PDB entry 1fsk

View 1fsk on RCSB PDB site
Description: complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1
Deposited on 2000-09-11, released 2000-10-02
The last revision prior to the SCOP 1.63 freeze date was dated 2000-10-02, with a file datestamp of 2000-10-02.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.253
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskA (A:)
    gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
    glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskB (B:)
    nivltqspksmsvsvgervtlsckasenvdtyvfwfqqkpdqspklllygpsnrytgvpd
    rftgsgsttdftltissvqaedladyhcgqsysypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskC (C:)
    qvqlqqpgtelvrpgasvilsckasgytftsywinwvkqrpgqglewvgnifpsdsytny
    nqkfkdkatltvdkssstaymqvnsptsedsavyyctrgardtwfaywgqgtlvtvsvak
    ttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskD (D:)
    gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
    glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskE (E:)
    nivltqspksmsvsvgervtlsckasenvdtyvfwfqqkpdqspklllygpsnrytgvpd
    rftgsgsttdftltissvqaedladyhcgqsysypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskF (F:)
    qvqlqqpgtelvrpgasvilsckasgytftsywinwvkqrpgqglewvgnifpsdsytny
    nqkfkdkatltvdkssstaymqvnsptsedsavyyctrgardtwfaywgqgtlvtvsvak
    ttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskG (G:)
    gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
    glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskH (H:)
    nivltqspksmsvsvgervtlsckasenvdtyvfwfqqkpdqspklllygpsnrytgvpd
    rftgsgsttdftltissvqaedladyhcgqsysypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskI (I:)
    qvqlqqpgtelvrpgasvilsckasgytftsywinwvkqrpgqglewvgnifpsdsytny
    nqkfkdkatltvdkssstaymqvnsptsedsavyyctrgardtwfaywgqgtlvtvsvak
    ttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskJ (J:)
    gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
    glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskK (K:)
    nivltqspksmsvsvgervtlsckasenvdtyvfwfqqkpdqspklllygpsnrytgvpd
    rftgsgsttdftltissvqaedladyhcgqsysypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fskL (L:)
    qvqlqqpgtelvrpgasvilsckasgytftsywinwvkqrpgqglewvgnifpsdsytny
    nqkfkdkatltvdkssstaymqvnsptsedsavyyctrgardtwfaywgqgtlvtvsvak
    ttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc