PDB entry 1fsb

View 1fsb on RCSB PDB site
Description: structure of the egf domain of p-selectin, nmr, 19 structures
Class: cell adhesion protein
Keywords: egf-like domain, cell adhesion protein, transmembrane, glycoprotein
Deposited on 1996-03-25, released 1997-04-01
The last revision prior to the SCOP 1.75 freeze date was dated 1997-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR19
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p-selectin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fsba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fsbA (A:)
    tascqdmscskqgecletignytcscypgfygpeceyvre