PDB entry 1fs6

View 1fs6 on RCSB PDB site
Description: glucosamine-6-phosphate deaminase from e.coli, t conformer, at 2.2a resolution
Deposited on 2000-09-08, released 2002-01-04
The last revision prior to the SCOP 1.59 freeze date was dated 2002-01-04, with a file datestamp of 2002-01-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.214
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1fs6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fs6A (A:)
    mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
    vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
    yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
    vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
    epstmelkvktlryfneleaenikgl