PDB entry 1fs2

View 1fs2 on RCSB PDB site
Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex
Class: ligase
Keywords: Skp1, Skp2, F-box, LRRs, leucine-rich repeats, SCF, ubiquitin, E3, ubiquitin protein ligase
Deposited on 2000-09-08, released 2000-11-29
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.246
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: skp2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fs2a1, d1fs2a2
  • Chain 'B':
    Compound: skp1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fs2b1, d1fs2b2
  • Chain 'C':
    Compound: skp2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fs2c1, d1fs2c2
  • Chain 'D':
    Compound: skp1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fs2d1, d1fs2d2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fs2A (A:)
    renfpgvswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldefrvqhm
    dlsnsvievstlhgilsqcsklqnlsleglrlsdpivntlaknsnlvrlnlsgcsgfsef
    alqtllsscsrldelnlswcfdftekhvqvavahvsetitqlnlsgyrknlqksdlstlv
    rrcpnlvhldlsdsvmlkndcfqeffqlnylqhlslsrcydiipetllelgeiptlktlq
    vfgivpdgtlqllkealphlqincshfttiar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fs2A (A:)
    pgvswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldefrvqhmdlsn
    svievstlhgilsqcsklqnlsleglrlsdpivntlaknsnlvrlnlsgcsgfsefalqt
    llsscsrldelnlswcfdftekhvqvavahvsetitqlnlsgyrknlqksdlstlvrrcp
    nlvhldlsdsvmlkndcfqeffqlnylqhlslsrcydiipetllelgeiptlktlqvfgi
    vpdgtlqllkealphlqin
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fs2B (B:)
    mpsiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhk
    ddppppeddenkekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanm
    ikgktpeeirktfnikndfte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fs2B (B:)
    psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
    dkrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirkt
    fnikndft
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fs2C (C:)
    renfpgvswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldefrvqhm
    dlsnsvievstlhgilsqcsklqnlsleglrlsdpivntlaknsnlvrlnlsgcsgfsef
    alqtllsscsrldelnlswcfdftekhvqvavahvsetitqlnlsgyrknlqksdlstlv
    rrcpnlvhldlsdsvmlkndcfqeffqlnylqhlslsrcydiipetllelgeiptlktlq
    vfgivpdgtlqllkealphlqincshfttiar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fs2C (C:)
    pgvswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldefrvqhmdlsn
    svievstlhgilsqcsklqnlsleglrlsdpivntlaknsnlvrlnlsgcsgfsefalqt
    llsscsrldelnlswcfdftekhvqvavahvsetitqlnlsgyrknlqksdlstlvrrcp
    nlvhldlsdsvmlkndcfqeffqlnylqhlslsrcydiipetllelgeiptlktlqvfgi
    vpdgtlqllkealphlqin
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fs2D (D:)
    mpsiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhk
    ddppppeddenkekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanm
    ikgktpeeirktfnikndfte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fs2D (D:)
    psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
    dkrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirkt
    fnikndft