PDB entry 1fs1

View 1fs1 on RCSB PDB site
Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex
Deposited on 2000-09-08, released 2000-11-29
The last revision prior to the SCOP 1.59 freeze date was dated 2000-11-29, with a file datestamp of 2000-11-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.218
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fs1A (A:)
    wdslpdelllgifsclclpellkvsgvckrwyrlasdeslw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fs1B (B:)
    psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
    dppppeddenkekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmi
    kgktpeeirktfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fs1B (B:)
    psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
    dpvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fs1C (C:)
    wdslpdelllgifsclclpellkvsgvckrwyrlasdeslw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fs1D (D:)
    psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
    dppppeddenkekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmi
    kgktpeeirktfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fs1D (D:)
    psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
    ddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfn