PDB entry 1frz

View 1frz on RCSB PDB site
Description: glucosamine-6-phosphate deaminase from e.coli, r conformer. complexed with the allosteric activator n-acetyl-glucosamine-6-phosphate at 2.2 a resolution
Deposited on 2000-09-07, released 2002-01-04
The last revision prior to the SCOP 1.59 freeze date was dated 2002-01-04, with a file datestamp of 2002-01-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.199
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1frza_
  • Chain 'B':
    Domains in SCOP 1.59: d1frzb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1frzA (A:)
    mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
    vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
    yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
    vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
    epstmelkvktlryfneleaenikgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1frzB (B:)
    mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
    vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
    yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
    vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
    epstmelkvktlryfneleaenikgl