PDB entry 1frn

View 1frn on RCSB PDB site
Description: the involvement of ser96 in the catalytic mechanism of ferredoxin-nadp+ reductase: structure-function relationship as studied by site-directed mutagenesis and x-ray crystallography
Class: oxidoreductase (nadp+(a),ferredoxin(a))
Keywords: oxidoreductase (nadp+(a),ferredoxin(a))
Deposited on 1995-03-31, released 1995-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.162
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin-nadp+ reductase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00455 (Start-313)
      • conflict (95)
    Domains in SCOPe 2.07: d1frna1, d1frna2
  • Heterogens: PO4, SO4, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1frnA (A:)
    qiasdveapppapakvekhskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhm
    vfshegeipyregqsvgvipdgedkngkphklrlyviassalgdfgdaksvslcvkrliy
    tndagetikgvcsnflcdlkpgaevkltgpvgkemlmpkdpnatiimlgtgtgiapfrsf
    lwkmffekhddykfnglawlflgvptsssllykeefekmkekapdnfrldfavsreqtne
    kgekmyiqtrmaqyavelwemlkkdntyfymcglkgmekgiddimvslaaaegidwieyk
    rqlkkaeqwnvevy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1frnA (A:)
    hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv
    ipdgedkngkphklrlyviassalgdfgdaksvslcvkrliytndagetikgvcsnflcd
    lkpgaevkltgpvgkemlmpkdpnatiimlgtgtgiapfrsflwkmffekhddykfngla
    wlflgvptsssllykeefekmkekapdnfrldfavsreqtnekgekmyiqtrmaqyavel
    wemlkkdntyfymcglkgmekgiddimvslaaaegidwieykrqlkkaeqwnvevy