PDB entry 1fr7

View 1fr7 on RCSB PDB site
Description: x-ray crystal structure of zinc-bound f93s/f95l/w97m carbonic anhydrase (caii) variant
Class: lyase
Keywords: carbonic anhydrase, metal binding, metal specificity, zinc, LYASE
Deposited on 2000-09-07, released 2001-01-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.24
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase II
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (Start-259)
      • engineered (92)
      • engineered (94)
      • engineered (96)
    Domains in SCOPe 2.03: d1fr7a_
  • Chain 'B':
    Compound: carbonic anhydrase II
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (Start-259)
      • engineered (92)
      • engineered (94)
      • engineered (96)
    Domains in SCOPe 2.03: d1fr7b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fr7A (A:)
    mshhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslril
    nnghafnvefddsqdkavlkggpldgtyrliqshlhmgsldgqgsehtvdkkkyaaelhl
    vhwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdp
    rgllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelm
    vdnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fr7A (A:)
    wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
    afnvefddsqdkavlkggpldgtyrliqshlhmgsldgqgsehtvdkkkyaaelhlvhwn
    tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
    pesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
    rpaqplknrqikasfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fr7B (B:)
    mshhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslril
    nnghafnvefddsqdkavlkggpldgtyrliqshlhmgsldgqgsehtvdkkkyaaelhl
    vhwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdp
    rgllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelm
    vdnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fr7B (B:)
    wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
    afnvefddsqdkavlkggpldgtyrliqshlhmgsldgqgsehtvdkkkyaaelhlvhwn
    tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
    pesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
    rpaqplknrqikasfk