PDB entry 1fr1

View 1fr1 on RCSB PDB site
Description: refined crystal structure of beta-lactamase from citrobacter freundii indicates a mechanism for beta-lactam hydrolysis
Class: hydrolase
Keywords: Hydrolase, Antibiotic Resistance, Class C Beta-lactamase
Deposited on 2000-09-07, released 2001-01-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Citrobacter freundii [TaxId:546]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46041 (0-360)
      • see remark 999 (174-175)
      • see remark 999 (179)
      • see remark 999 (227)
      • see remark 999 (252)
      • see remark 999 (277)
      • see remark 999 (284)
      • see remark 999 (347)
    Domains in SCOPe 2.01: d1fr1a_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Citrobacter freundii [TaxId:546]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46041 (0-360)
      • see remark 999 (174-175)
      • see remark 999 (179)
      • see remark 999 (227)
      • see remark 999 (252)
      • see remark 999 (277)
      • see remark 999 (284)
      • see remark 999 (347)
    Domains in SCOPe 2.01: d1fr1b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fr1A (A:)
    aakteqqiadivnrtitplmqeqaipgmavaiiyqgkpyyftwgkadiannrpvtqqtlf
    elgsvsktfngvlggdaiargeiklsdpvtqywpeltgkqwqgisllhlatytagglplq
    vpddvtdkaallrfyqnwqpqwapgakrlyanssiglfgalavkpsgmsyeeamskrvlh
    plklahtwitvpqseqkdyawgyregkpvhvspgqldaeaygvkssvidmtrwvqanmda
    sqvqektlqqgielaqsrywrigdmyqglgwemlnwpvkadsiisgsdskvalaalpave
    vnppapavkaswvhktgstggfgsyvafvpeknlgivmlanksypnpvrveaawrilekl
    q
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fr1B (B:)
    aakteqqiadivnrtitplmqeqaipgmavaiiyqgkpyyftwgkadiannrpvtqqtlf
    elgsvsktfngvlggdaiargeiklsdpvtqywpeltgkqwqgisllhlatytagglplq
    vpddvtdkaallrfyqnwqpqwapgakrlyanssiglfgalavkpsgmsyeeamskrvlh
    plklahtwitvpqseqkdyawgyregkpvhvspgqldaeaygvkssvidmtrwvqanmda
    sqvqektlqqgielaqsrywrigdmyqglgwemlnwpvkadsiisgsdskvalaalpave
    vnppapavkaswvhktgstggfgsyvafvpeknlgivmlanksypnpvrveaawrilekl
    q