PDB entry 1fqv

View 1fqv on RCSB PDB site
Description: Insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex
Deposited on 2000-09-06, released 2000-11-29
The last revision prior to the SCOP 1.69 freeze date was dated 2000-11-29, with a file datestamp of 2000-11-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.275
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fqvA (A:)
    renfpgvswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldltgknlh
    pdvtgrllsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvievstlhgilsqcskl
    qnlsleglrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllsscsrldelnlswcfd
    ftekhvqvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcf
    qeffqlnylqhlslsrcydiipetllelgeiptlktlqvfgivpdgtlqllkealphlqi
    ncshfttiarptignkknqeiwgikcrltlqkpscl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fqvA (A:)
    vswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldltgknlhpdvtgr
    llsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvievstlhgilsqcsklqnlsle
    glrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllsscsrldelnlswcfdftekhv
    qvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcfqeffql
    nylqhlslsrcydiipetllelgeiptlktlqvfgivpdgtlqllkealphlqincshft
    tiarptignkknqeiwgikcrltlq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fqvB (B:)
    mpsiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhk
    ddpggsgtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpee
    irktfnikndfteeeeaqvrkenqwceek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fqvB (B:)
    psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
    dipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfnikn
    dfteeeeaqvrkenqwc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fqvC (C:)
    renfpgvswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldltgknlh
    pdvtgrllsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvievstlhgilsqcskl
    qnlsleglrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllsscsrldelnlswcfd
    ftekhvqvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcf
    qeffqlnylqhlslsrcydiipetllelgeiptlktlqvfgivpdgtlqllkealphlqi
    ncshfttiarptignkknqeiwgikcrltlqkpscl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fqvC (C:)
    vswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldltgknlhpdvtgr
    llsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvievstlhgilsqcsklqnlsle
    glrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllsscsrldelnlswcfdftekhv
    qvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcfqeffql
    nylqhlslsrcydiipetllelgeiptlktlqvfgivpdgtlqllkealphlqincshft
    tiarptignkknqeiwgikcrltlq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fqvD (D:)
    mpsiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhk
    ddpggsgtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpee
    irktfnikndfteeeeaqvrkenqwceek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fqvD (D:)
    psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
    dipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfnikn
    dfteeeeaqvrkenqwc
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1fqvE (E:)
    renfpgvswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldltgknlh
    pdvtgrllsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvievstlhgilsqcskl
    qnlsleglrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllsscsrldelnlswcfd
    ftekhvqvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcf
    qeffqlnylqhlslsrcydiipetllelgeiptlktlqvfgivpdgtlqllkealphlqi
    ncshfttiarptignkknqeiwgikcrltlqkpscl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fqvE (E:)
    vswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldltgknlhpdvtgr
    llsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvievstlhgilsqcsklqnlsle
    glrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllsscsrldelnlswcfdftekhv
    qvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcfqeffql
    nylqhlslsrcydiipetllelgeiptlktlqvfgivpdgtlqllkealphlqincshft
    tiarptignkknqeiwgikcrltlq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1fqvF (F:)
    mpsiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhk
    ddpggsgtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpee
    irktfnikndfteeeeaqvrkenqwceek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fqvF (F:)
    psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
    dipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfnikn
    dfteeeeaqvrkenqwc
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1fqvG (G:)
    renfpgvswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldltgknlh
    pdvtgrllsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvievstlhgilsqcskl
    qnlsleglrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllsscsrldelnlswcfd
    ftekhvqvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcf
    qeffqlnylqhlslsrcydiipetllelgeiptlktlqvfgivpdgtlqllkealphlqi
    ncshfttiarptignkknqeiwgikcrltlqkpscl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fqvG (G:)
    vswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldltgknlhpdvtgr
    llsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvievstlhgilsqcsklqnlsle
    glrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllsscsrldelnlswcfdftekhv
    qvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcfqeffql
    nylqhlslsrcydiipetllelgeiptlktlqvfgivpdgtlqllkealphlqincshft
    tiarptignkknqeiwgikcrltlq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1fqvH (H:)
    mpsiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhk
    ddpggsgtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpee
    irktfnikndfteeeeaqvrkenqwceek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fqvH (H:)
    psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
    dipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfnikn
    dfteeeeaqvrkenqwc
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1fqvI (I:)
    renfpgvswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldltgknlh
    pdvtgrllsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvievstlhgilsqcskl
    qnlsleglrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllsscsrldelnlswcfd
    ftekhvqvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcf
    qeffqlnylqhlslsrcydiipetllelgeiptlktlqvfgivpdgtlqllkealphlqi
    ncshfttiarptignkknqeiwgikcrltlqkpscl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fqvI (I:)
    vswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldltgknlhpdvtgr
    llsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvievstlhgilsqcsklqnlsle
    glrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllsscsrldelnlswcfdftekhv
    qvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcfqeffql
    nylqhlslsrcydiipetllelgeiptlktlqvfgivpdgtlqllkealphlqincshft
    tiarptignkknqeiwgikcrltlq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1fqvJ (J:)
    mpsiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhk
    ddpggsgtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpee
    irktfnikndfteeeeaqvrkenqwceek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fqvJ (J:)
    psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
    dipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfnikn
    dfteeeeaqvrkenqwc
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1fqvK (K:)
    renfpgvswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldltgknlh
    pdvtgrllsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvievstlhgilsqcskl
    qnlsleglrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllsscsrldelnlswcfd
    ftekhvqvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcf
    qeffqlnylqhlslsrcydiipetllelgeiptlktlqvfgivpdgtlqllkealphlqi
    ncshfttiarptignkknqeiwgikcrltlqkpscl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fqvK (K:)
    vswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldltgknlhpdvtgr
    llsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvievstlhgilsqcsklqnlsle
    glrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllsscsrldelnlswcfdftekhv
    qvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcfqeffql
    nylqhlslsrcydiipetllelgeiptlktlqvfgivpdgtlqllkealphlqincshft
    tiarptignkknqeiwgikcrltlq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1fqvL (L:)
    mpsiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhk
    ddpggsgtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpee
    irktfnikndfteeeeaqvrkenqwceek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fqvL (L:)
    psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
    dipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfnikn
    dfteeeeaqvrkenqwc
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1fqvM (M:)
    renfpgvswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldltgknlh
    pdvtgrllsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvievstlhgilsqcskl
    qnlsleglrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllsscsrldelnlswcfd
    ftekhvqvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcf
    qeffqlnylqhlslsrcydiipetllelgeiptlktlqvfgivpdgtlqllkealphlqi
    ncshfttiarptignkknqeiwgikcrltlqkpscl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fqvM (M:)
    vswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldltgknlhpdvtgr
    llsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvievstlhgilsqcsklqnlsle
    glrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllsscsrldelnlswcfdftekhv
    qvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcfqeffql
    nylqhlslsrcydiipetllelgeiptlktlqvfgivpdgtlqllkealphlqincshft
    tiarptignkknqeiwgikcrltlq
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1fqvN (N:)
    mpsiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhk
    ddpggsgtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpee
    irktfnikndfteeeeaqvrkenqwceek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fqvN (N:)
    psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
    dipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfnikn
    dfteeeeaqvrkenqwc
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1fqvO (O:)
    renfpgvswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldltgknlh
    pdvtgrllsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvievstlhgilsqcskl
    qnlsleglrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllsscsrldelnlswcfd
    ftekhvqvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcf
    qeffqlnylqhlslsrcydiipetllelgeiptlktlqvfgivpdgtlqllkealphlqi
    ncshfttiarptignkknqeiwgikcrltlqkpscl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fqvO (O:)
    vswdslpdelllgifsclclpellkvsgvckrwyrlasdeslwqtldltgknlhpdvtgr
    llsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvievstlhgilsqcsklqnlsle
    glrlsdpivntlaknsnlvrlnlsgcsgfsefalqtllsscsrldelnlswcfdftekhv
    qvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcfqeffql
    nylqhlslsrcydiipetllelgeiptlktlqvfgivpdgtlqllkealphlqincshft
    tiarptignkknqeiwgikcrltlq
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1fqvP (P:)
    mpsiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhk
    ddpggsgtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpee
    irktfnikndfteeeeaqvrkenqwceek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fqvP (P:)
    psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
    dipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfnikn
    dfteeeeaqvrkenqwc