PDB entry 1fqj

View 1fqj on RCSB PDB site
Description: crystal structure of the heterotrimeric complex of the rgs domain of rgs9, the gamma subunit of phosphodiesterase and the gt/i1 chimera alpha subunit [(rgs9)-(pdegamma)-(gt/i1alpha)-(gdp)-(alf4-)-(mg2+)]
Deposited on 2000-09-05, released 2001-02-28
The last revision prior to the SCOP 1.55 freeze date was dated 2001-02-28, with a file datestamp of 2001-02-28.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.233
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fqjA (A:)
    rtvkllllgagesgkstivkqmkiihqdgysleeclefiaiiygntlqsilaivramttl
    niqygdsarqddarklmhmadtieegtmpkemsdiiqrlwkdsgiqacfdraseyqlnds
    agyylsdlerlvtpgyvpteqdvlrsrvkttgiietqfsfkdlnfrmfdvggqrserkkw
    ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
    dlfeekikksplticypeyagsntyeeagnyikvqflelnmrrdvkeiyshmtcatdtqn
    vkfvfdavtdiiikenl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fqjB (B:)
    diptkmrverwafnfselirdpkgrqsfqhflrkefsgenlgfweacedlkygdqskvke
    kaeeiyklflapgarrwinidgktmditvkglkhphryvldaaqthiymlmkkdsyaryl
    kspiykemlakai
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fqjD (D:)
    rtvkllllgagesgkstivkqmkiihqdgysleeclefiaiiygntlqsilaivramttl
    niqygdsarqddarklmhmadtieegtmpkemsdiiqrlwkdsgiqacfdraseyqlnds
    agyylsdlerlvtpgyvpteqdvlrsrvkttgiietqfsfkdlnfrmfdvggqrserkkw
    ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
    dlfeekikksplticypeyagsntyeeagnyikvqflelnmrrdvkeiyshmtcatdtqn
    vkfvfdavtdiiike
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fqjE (E:)
    fwdlnaklvdiptkmrverwafnfselirdpkgrqsfqhflrkefsgenlgfweacedlk
    ygdqskvkekaeeiyklflapgarrwinidgktmditvkglkhphryvldaaqthiymlm
    kkdsyarylkspiykemlaka