PDB entry 1fpt

View 1fpt on RCSB PDB site
Description: three-dimensional structure of the complex between the fab fragment of an neutralizing antibody for type 1 poliovirus and its viral epitope
Class: complex (antibody/pv-1 fragment)
Keywords: COMPLEX (ANTIBODY-PV-1 FRAGMENT), COMPLEX (ANTIBODY-PV-1 FRAGMENT) complex
Deposited on 1995-01-26, released 1995-03-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.23
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2a-kappa c3 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fpth1, d1fpth2
  • Chain 'L':
    Compound: igg2a-kappa c3 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FPT (0-217)
    Domains in SCOPe 2.06: d1fptl1, d1fptl2
  • Chain 'P':
    Compound: fab fragment of an neutralizing antibody for type 1 poliovirus
    Species: Human poliovirus 1 [TaxId:12081]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fptH (H:)
    qvqlqqsgaelvrpgtsvkvsckasgyaftnyliqwikqrpgqglewigvinpgsggtdy
    nanfkgkatltadksssivymqlssltsddsavyfcardfydydvgfdywgqgttltvss
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fptL (L:)
    dvvmtqtplslpvslgdqasiscsssqslvhsngktylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtyftlkisrveaedlgvyfcsqsthvpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgsevqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'P':
    No sequence available.