PDB entry 1fpt

View 1fpt on RCSB PDB site
Description: three-dimensional structure of the complex between the fab fragment of an neutralizing antibody for type 1 poliovirus and its viral epitope
Class: complex (antibody/pv-1 fragment)
Keywords: complex (antibody/pv-1 fragment)
Deposited on 1995-01-26, released 1995-03-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.23
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2a-kappa c3 fab (heavy chain)
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fpth1, d1fpth2
  • Chain 'L':
    Compound: igg2a-kappa c3 fab (light chain)
    Species: Mus musculus
    Domains in SCOP 1.73: d1fptl1, d1fptl2
  • Chain 'P':
    Compound: fab fragment of an neutralizing antibody for type 1 poliovirus
    Species: Poliovirus type 1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fptH (H:)
qvqlqqsgaelvrpgtsvkvsckasgyaftnyliqwikqrpgqglewigvinpgsggtdy
nanfkgkatltadksssivymqlssltsddsavyfcardfydydvgfdywgqgttltvss
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fptL (L:)
dvvmtqtplslpvslgdqasiscsssqslvhsngktylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtyftlkisrveaedlgvyfcsqsthvpytfgggtkleikradaaptv
sifppsseqltsggasvvcflnnfypkdinvkwkidgsevqngvlnswtdqdskdstysm
sstltltkdeyerhnsytceathktstspivksfnrnec

  • Chain 'P':
    No sequence available.