PDB entry 1fpt

View 1fpt on RCSB PDB site
Description: three-dimensional structure of the complex between the fab fragment of an neutralizing antibody for type 1 poliovirus and its viral epitope
Deposited on 1995-01-26, released 1995-03-31
The last revision prior to the SCOP 1.65 freeze date was dated 2001-05-30, with a file datestamp of 2001-05-30.
Experiment type: -
Resolution: 3 Å
R-factor: 0.23
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fptH (H:)
    qvqlqqsgaelvrpgtsvkvsckasgyaftnyliqwikqrpgqglewigvinpgsggtdy
    nanfkgkatltadksssivymqlssltsddsavyfcardfydydvgfdywgqgttltvss
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fptL (L:)
    dvvmtqtplslpvslgdqasiscsssqslvhsngktylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtyftlkisrveaedlgvyfcsqsthvpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgsevqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec