PDB entry 1fpo

View 1fpo on RCSB PDB site
Description: hsc20 (hscb), a j-type co-chaperone from e. coli
Deposited on 2000-08-31, released 2000-12-08
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-08, with a file datestamp of 2000-12-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.216
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpoA (A:)
    mdyftlfglparyqldtqalslrfqdlqrqyhpdkfasgsqaeqlaavqqsatinqawqt
    lrhplmraeyllslhgfdlaseqhtvrdtaflmeqlelreeldeieqakdearlesfikr
    vkkmfdtrhqlmveqldnetwdaaadtcrklrfldklrssaeqleeklldf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpoB (B:)
    mdyftlfglparyqldtqalslrfqdlqrqyhpdkfasgsqaeqlaavqqsatinqawqt
    lrhplmraeyllslhgfdlaseqhtvrdtaflmeqlelreeldeieqakdearlesfikr
    vkkmfdtrhqlmveqldnetwdaaadtcrklrfldklrssaeqleeklldf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fpoC (C:)
    mdyftlfglparyqldtqalslrfqdlqrqyhpdkfasgsqaeqlaavqqsatinqawqt
    lrhplmraeyllslhgfdlaseqhtvrdtaflmeqlelreeldeieqakdearlesfikr
    vkkmfdtrhqlmveqldnetwdaaadtcrklrfldklrssaeqleeklldf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fpoC (C:)
    mdyftlfglparyqldtqalslrfqdlqrqlaavqqsatinqawqtlrhplmraeyllsl
    hgfdlaseqhtvrdtaflmeqlelreeldeieqakdearlesfikrvkkmfdtrhqlmve
    qldnetwdaaadtcrklrfldklrssaeqleeklldf