PDB entry 1fpo

View 1fpo on RCSB PDB site
Description: hsc20 (hscb), a j-type co-chaperone from e. coli
Class: chaperone
Keywords: molecular chaperone
Deposited on 2000-08-31, released 2000-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.216
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chaperone protein hscb
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6L9 (0-170)
      • engineered (147)
    Domains in SCOPe 2.07: d1fpoa1, d1fpoa2
  • Chain 'B':
    Compound: chaperone protein hscb
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6L9 (0-170)
      • engineered (147)
    Domains in SCOPe 2.07: d1fpob1, d1fpob2
  • Chain 'C':
    Compound: chaperone protein hscb
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6L9 (0-170)
      • engineered (147)
    Domains in SCOPe 2.07: d1fpoc1, d1fpoc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpoA (A:)
    mdyftlfglparyqldtqalslrfqdlqrqyhpdkfasgsqaeqlaavqqsatinqawqt
    lrhplmraeyllslhgfdlaseqhtvrdtaflmeqlelreeldeieqakdearlesfikr
    vkkmfdtrhqlmveqldnetwdaaadtcrklrfldklrssaeqleeklldf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fpoB (B:)
    mdyftlfglparyqldtqalslrfqdlqrqyhpdkfasgsqaeqlaavqqsatinqawqt
    lrhplmraeyllslhgfdlaseqhtvrdtaflmeqlelreeldeieqakdearlesfikr
    vkkmfdtrhqlmveqldnetwdaaadtcrklrfldklrssaeqleeklldf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fpoC (C:)
    mdyftlfglparyqldtqalslrfqdlqrqyhpdkfasgsqaeqlaavqqsatinqawqt
    lrhplmraeyllslhgfdlaseqhtvrdtaflmeqlelreeldeieqakdearlesfikr
    vkkmfdtrhqlmveqldnetwdaaadtcrklrfldklrssaeqleeklldf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fpoC (C:)
    mdyftlfglparyqldtqalslrfqdlqrqlaavqqsatinqawqtlrhplmraeyllsl
    hgfdlaseqhtvrdtaflmeqlelreeldeieqakdearlesfikrvkkmfdtrhqlmve
    qldnetwdaaadtcrklrfldklrssaeqleeklldf