PDB entry 1fp5

View 1fp5 on RCSB PDB site
Description: crystal structure analysis of the human ige-fc cepsilon3-cepsilon4 fragment.
Class: immune system
Keywords: Antibody, Fc, Immunoglobin fold, "closed" IgE-Fc, IMMUNE SYSTEM
Deposited on 2000-08-30, released 2000-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.242
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ige heavy chain epsilon-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fp5a1, d1fp5a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fp5A (A:)
    adpcdsnprgvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhs
    trkeekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapev
    yafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffv
    fsrlevtraeweqkdeficravheaaspsqtvqravsvnpgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fp5A (A:)
    vsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhstrkeekqrng
    tltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpewpg
    srdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevtrae
    weqkdeficravheaaspsqtvqravsv