PDB entry 1fo1

View 1fo1 on RCSB PDB site
Description: crystal structure of the rna-binding domain of the mrna export factor tap
Deposited on 2000-08-24, released 2000-11-03
The last revision prior to the SCOP 1.61 freeze date was dated 2000-11-03, with a file datestamp of 2000-11-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.25
AEROSPACI score: -1.84 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fo1A (A:)
    tipygrkydkawllsmiqskcsvpftpiefhyentraqffvedastasalkavnykildr
    enrrisiiinssapphtilnelkpeqveqlklimskrydgsqqvldlkglrsdpdlvaqn
    idvvlnrrscmaatlriieenipellslnlsnnrlyrlddmssivqkapnlkilnlsgne
    lksereldkikglkleelwldgnslcdtfrdqstyisairerfpkllrldghelpppiaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fo1A (A:)
    tipygrkydkawllsmiqskcftpiefhyentraalkavnykildrenrrisiiielkpe
    qveqlklimskrydgsqqvldlkglrsdpdlvaqnidvvlnrrscmaatlriieenipel
    lslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwldgnsl
    cdtfrdqstyisairerfpkllrldghelpppiaf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fo1B (B:)
    elkpeqveqlklimskrydgsqqvldlkglrsdpdlvaqnidvvlnrrscmaatlriiee
    nipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwl
    dgnslcdtfrdqstyisairerfpkllrldghelpppiafdve