PDB entry 1fo1

View 1fo1 on RCSB PDB site
Description: crystal structure of the RNA-binding domain of the mRNA export factor tap
Class: RNA binding protein
Keywords: ribonucleoprotein (RNP,RBD or RRM) and leucine-rich-repeat (LRR), RNA BINDING PROTEIN
Deposited on 2000-08-24, released 2000-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.25
AEROSPACI score: -1.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nuclear RNA export factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBU9
      • conflict (124)
    Domains in SCOPe 2.07: d1fo1a1, d1fo1a2
  • Chain 'B':
    Compound: nuclear RNA export factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBU9
      • conflict (124)
    Domains in SCOPe 2.07: d1fo1b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fo1A (A:)
    pperggagtsqdgtskncfkitipygrkydkawllsmiqskcsvpftpiefhyentraqf
    fvedastasalkavnykildrenrrisiiinssapphtilnelkpeqveqlklimskryd
    gsqqvldlkglrsdpdlvaqnidvvlnrrscmaatlriieenipellslnlsnnrlyrld
    dmssivqkapnlkilnlsgnelksereldkikglkleelwldgnslcdtfrdqstyisai
    rerfpkllrldghelpppiafdveapttlpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fo1A (A:)
    tipygrkydkawllsmiqskcftpiefhyentraalkavnykildrenrrisiiielkpe
    qveqlklimskrydgsqqvldlkglrsdpdlvaqnidvvlnrrscmaatlriieenipel
    lslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwldgnsl
    cdtfrdqstyisairerfpkllrldghelpppiaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fo1B (B:)
    pperggagtsqdgtskncfkitipygrkydkawllsmiqskcsvpftpiefhyentraqf
    fvedastasalkavnykildrenrrisiiinssapphtilnelkpeqveqlklimskryd
    gsqqvldlkglrsdpdlvaqnidvvlnrrscmaatlriieenipellslnlsnnrlyrld
    dmssivqkapnlkilnlsgnelksereldkikglkleelwldgnslcdtfrdqstyisai
    rerfpkllrldghelpppiafdveapttlpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fo1B (B:)
    elkpeqveqlklimskrydgsqqvldlkglrsdpdlvaqnidvvlnrrscmaatlriiee
    nipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwl
    dgnslcdtfrdqstyisairerfpkllrldghelpppiafdve