PDB entry 1fo0

View 1fo0 on RCSB PDB site
Description: murine alloreactive scfv tcr-peptide-MHC class I molecule complex
Class: immune system
Keywords: t cell receptor, class I MHC, h-2kb, tcr-pmhc complex
Deposited on 2000-08-24, released 2000-10-02
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.218
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (bm3.3 t cell receptor alpha-chain)
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • GB AAA40182 (Start-115)
      • conflict (26)
      • insertion (94-95)
      • insertion (98-99)
      • conflict (100-101)
      • conflict (103-104)
      • conflict (107)
      • conflict (110)
      • conflict (112-113)
    Domains in SCOP 1.73: d1fo0a_
  • Chain 'B':
    Compound: protein (bm3.3 t cell receptor beta-chain)
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • GB AAA40254 (0-107)
      • conflict (94-97)
      • conflict (101)
      • conflict (105)
      • conflict (107)
      • conflict (110-111)
    Domains in SCOP 1.73: d1fo0b_
  • Chain 'H':
    Compound: protein (allogeneic h-2kb MHC class I molecule)
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fo0h1, d1fo0h2
  • Chain 'L':
    Compound: protein (beta-2 microglobulin)
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fo0l_
  • Chain 'P':
    Compound: naturally processed octapeptide pbm1
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fo0A (A:)
    qkvtqtqtsisvmekttvtmdcvyetqdssyflfwykqtasgeivflirqdsykkenatv
    ghyslnfqkpkssigliitatqiedsavyfcamrgdyggsgnklifgtgtllsvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fo0A (A:)
    kvtqtqtsisvmekttvtmdcvyetqdssyflfwykqtasgeivflirqdsykkenatvg
    hyslnfqkpkssigliitatqiedsavyfcamrgdyggsgnklifgtgtllsvkp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fo0B (B:)
    vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
    lpgadylatrvtdtelrlqvanmsqgrtlyctcsadrvgntlyfgegsrliv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fo0H (H:)
    mgphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpey
    weretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyayd
    gcdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatl
    lrtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdg
    tfqkwasvvvplgkeqyytchvyhqglpepltlrwe
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fo0L (L:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'P':
    No sequence available.