PDB entry 1fo0

View 1fo0 on RCSB PDB site
Description:
Deposited on 2000-08-24, released 2000-10-02
The last revision prior to the SCOP 1.67 freeze date was dated 2000-10-02, with a file datestamp of 2000-10-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.218
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1fo0a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1fo0b_
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1fo0h1, d1fo0h2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1fo0l_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fo0A (A:)
    qkvtqtqtsisvmekttvtmdcvyetqdssyflfwykqtasgeivflirqdsykkenatv
    ghyslnfqkpkssigliitatqiedsavyfcamrgdyggsgnklifgtgtllsvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fo0A (A:)
    kvtqtqtsisvmekttvtmdcvyetqdssyflfwykqtasgeivflirqdsykkenatvg
    hyslnfqkpkssigliitatqiedsavyfcamrgdyggsgnklifgtgtllsvkp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fo0B (B:)
    vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
    lpgadylatrvtdtelrlqvanmsqgrtlyctcsadrvgntlyfgegsrliv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fo0H (H:)
    mgphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpey
    weretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyayd
    gcdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatl
    lrtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdg
    tfqkwasvvvplgkeqyytchvyhqglpepltlrwe
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fo0L (L:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm