PDB entry 1fnv

View 1fnv on RCSB PDB site
Description: structure of streptococcal pyrogenic exotoxin a
Class: toxin
Keywords: Exotoxin A, superantigen, toxin
Deposited on 2000-08-23, released 2000-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exotoxin type a precursor (allele 1)
    Species: Streptococcus pyogenes phage T12 [TaxId:35344]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62560
      • conflict (152-153)
      • conflict (208-209)
    Domains in SCOPe 2.07: d1fnva1, d1fnva2
  • Chain 'B':
    Compound: exotoxin type a precursor (allele 1)
    Species: Streptococcus pyogenes phage T12 [TaxId:35344]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62560
      • conflict (152-153)
      • conflict (208-209)
    Domains in SCOPe 2.07: d1fnvb1, d1fnvb2
  • Chain 'C':
    Compound: exotoxin type a precursor (allele 1)
    Species: Streptococcus pyogenes phage T12 [TaxId:35344]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62560
      • conflict (152-153)
      • conflict (208-209)
    Domains in SCOPe 2.07: d1fnvc1, d1fnvc2
  • Chain 'D':
    Compound: exotoxin type a precursor (allele 1)
    Species: Streptococcus pyogenes phage T12 [TaxId:35344]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62560 (0-220)
      • conflict (152-153)
      • conflict (208-209)
    Domains in SCOPe 2.07: d1fnvd1, d1fnvd2
  • Heterogens: CD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnvA (A:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldnktsqievylttk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnvB (B:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldnktsqievylttk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnvC (C:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldnktsqievylttk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnvD (D:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldnktsqievylttk